Lineage for d1ibkh_ (1ibk H:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3043115Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 3043150Domain d1ibkh_: 1ibk H: [62171]
    complexed with mg, par, zn

Details for d1ibkh_

PDB Entry: 1ibk (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1ibkh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibkh_ i.1.1.1 (H:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d1ibkh_:

Click to download the PDB-style file with coordinates for d1ibkh_.
(The format of our PDB-style files is described here.)

Timeline for d1ibkh_: