Class b: All beta proteins [48724] (141 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (17 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S12 [50302] (1 species) |
Species Thermus thermophilus [TaxId:274] [50303] (14 PDB entries) |
Domain d1i96l_: 1i96 L: [62047] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ complexed with mg, wo2, zn |
PDB Entry: 1i96 (more details), 4.2 Å
SCOP Domain Sequences for d1i96l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus} ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk pkeaaktaakk
Timeline for d1i96l_: