Lineage for d1i96l_ (1i96 L:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374797Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (17 proteins)
    barrel, closed; n=5, S=8
  6. 374891Protein Ribosomal protein S12 [50302] (1 species)
  7. 374892Species Thermus thermophilus [TaxId:274] [50303] (14 PDB entries)
  8. 374902Domain d1i96l_: 1i96 L: [62047]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
    complexed with mg, wo2, zn

Details for d1i96l_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkeaaktaakk

SCOP Domain Coordinates for d1i96l_:

Click to download the PDB-style file with coordinates for d1i96l_.
(The format of our PDB-style files is described here.)

Timeline for d1i96l_: