Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.4: Translational machinery components [53137] (2 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein S11 [53141] (1 species) |
Species Thermus thermophilus [TaxId:274] [53142] (10 PDB entries) |
Domain d1i96k_: 1i96 K: [62046] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ |
PDB Entry: 1i96 (more details), 4.2 Å
SCOP Domain Sequences for d1i96k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus} kkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaal daakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr kas
Timeline for d1i96k_: