Lineage for d1i96q_ (1i96 Q:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59561Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (10 proteins)
  6. 59611Protein Ribosomal protein S17 [50304] (2 species)
  7. 59614Species Thermus thermophilus [TaxId:274] [50305] (10 PDB entries)
  8. 59622Domain d1i96q_: 1i96 Q: [62052]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_

Details for d1i96q_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeerykvgdvveiie
arpiskrkrfrvlrlveegrldlvekylvrrqnyaslskrggka

SCOP Domain Coordinates for d1i96q_:

Click to download the PDB-style file with coordinates for d1i96q_.
(The format of our PDB-style files is described here.)

Timeline for d1i96q_: