Lineage for d1i96g_ (1i96 G:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1092301Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1092302Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1092303Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1092304Protein Ribosomal protein S7 [47975] (4 species)
  7. 1092334Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1092366Domain d1i96g_: 1i96 G: [62042]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
    complexed with mg, wo2, zn

Details for d1i96g_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1i96g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d1i96g_:

Click to download the PDB-style file with coordinates for d1i96g_.
(The format of our PDB-style files is described here.)

Timeline for d1i96g_: