Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) |
Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries) Uniprot P80372 |
Domain d1i96c2: 1i96 C:107-207 [62037] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ complexed with mg, wo2, zn |
PDB Entry: 1i96 (more details), 4.2 Å
SCOPe Domain Sequences for d1i96c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]} qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d1i96c2: