SCOPe 2.01: Domain d1i6va1: 1i6v A:6-49,A:173-229

Lineage for d1i6va1 (1i6v A:6-49,A:173-229)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus aquaticus [TaxId:271] [64314] (4 PDB entries)

8. Domain d1i6va1: 1i6v A:6-49,A:173-229 [61852]
   Other proteins in same PDB: d1i6va2, d1i6vb2, d1i6vc_, d1i6vd_, d1i6ve_
   protein/DNA complex; protein/RNA complex; complexed with mg, rfp, zn

Details for d1i6va1

PDB Entry: 1i6v, 3.3 Å

PDB Description: thermus aquaticus core rna polymerase-rifampicin complex

PDB Compounds: (A:) DNA-directed RNA polymerase

SCOPe Domain Sequences for d1i6va1:

Sequence; same for both SEQRES and ATOM records:

>d1i6va1 d.74.3.1 (A:6-49,A:173-229) RNA polymerase alpha {Thermus aquaticus [TaxId: 271]}
lkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlg
qrtdldkltlriwtdgsvtplealnqavailkehlnyfanpe

Timeline for d1i6va1:

• d1i6va1 first appeared in SCOP 1.57
  
• d1i6va1 appears in SCOP 1.75
  
• d1i6va1 appears in SCOPe 2.02
  
• d1i6va1 appears in the current release, SCOPe 2.08