Lineage for d1i6hi2 (1i6h I:50-120)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430209Superfamily g.41.3: Zinc beta-ribbon [57783] (3 families) (S)
  5. 430210Family g.41.3.1: Transcriptional factor domain [57784] (3 proteins)
  6. 430211Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
    contains two differently decorated domains of this fold
  7. 430214Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (4 PDB entries)
  8. 430222Domain d1i6hi2: 1i6h I:50-120 [61840]
    Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hj_, d1i6hk_, d1i6hl_
    complexed with mg, zn

Details for d1i6hi2

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex

SCOP Domain Sequences for d1i6hi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6hi2 g.41.3.1 (I:50-120) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtq

SCOP Domain Coordinates for d1i6hi2:

Click to download the PDB-style file with coordinates for d1i6hi2.
(The format of our PDB-style files is described here.)

Timeline for d1i6hi2: