Lineage for d1i6he1 (1i6h E:2-143)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397005Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 397259Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 397260Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)
  6. 397261Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)
  7. 397262Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (5 PDB entries)
  8. 397267Domain d1i6he1: 1i6h E:2-143 [61835]
    Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_
    complexed with mg, zn

Details for d1i6he1

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex

SCOP Domain Sequences for d1i6he1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6he1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

SCOP Domain Coordinates for d1i6he1:

Click to download the PDB-style file with coordinates for d1i6he1.
(The format of our PDB-style files is described here.)

Timeline for d1i6he1: