Lineage for d1i19b2 (1i19 B:57-273)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138297Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 138298Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 138299Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (4 proteins)
  6. 138300Protein Cholesterol oxidase [64414] (1 species)
  7. 138301Species Brevibacterium sterolicum [TaxId:1702] [64415] (1 PDB entry)
  8. 138303Domain d1i19b2: 1i19 B:57-273 [61525]
    Other proteins in same PDB: d1i19a1, d1i19b1

Details for d1i19b2

PDB Entry: 1i19 (more details), 1.7 Å

PDB Description: crystal structure of cholesterol oxidase from b.sterolicum

SCOP Domain Sequences for d1i19b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i19b2 d.145.1.1 (B:57-273) Cholesterol oxidase {Brevibacterium sterolicum}
vaplptppnfpndialfqqayqnwskeimldatwvcspktpqdvvrlanwahehdykirp
rgamhgwtpltvekganvekviladtmthlngitvntggpvatvtagagasieaivtelq
khdlgwanlpapgvlsiggalavnahgaalpavgqttlpghtygslsnlvteltavvwng
ttyaletyqrndpritplltnlgrcfltsvtmqagpn

SCOP Domain Coordinates for d1i19b2:

Click to download the PDB-style file with coordinates for d1i19b2.
(The format of our PDB-style files is described here.)

Timeline for d1i19b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i19b1