SCOP 1.57: Domain d1hzhl1: 1hzh L:1-107

Lineage for d1hzhl1 (1hzh L:1-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Intact IgG B12 antibody (human), kappa L chain [63639] (1 PDB entry)

8. Domain d1hzhl1: 1hzh L:1-107 [61445]
   Other proteins in same PDB: d1hzhh2, d1hzhh3, d1hzhh4, d1hzhk2, d1hzhk3, d1hzhk4, d1hzhl2, d1hzhm2

Details for d1hzhl1

PDB Entry: 1hzh, 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhl1:

Sequence; same for both SEQRES and ATOM records:

>d1hzhl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Intact IgG B12 antibody (human), kappa L chain}
eivltqspgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk

Timeline for d1hzhl1:

• d1hzhl1 is new in SCOP 1.57
  
• d1hzhl1 appears in SCOP 1.59
  
• d1hzhl1 appears in the current release, SCOPe 2.08