Lineage for d1hzhk2 (1hzh K:114-235)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 54056Species Intact IgG B12 antibody (human), kappa L chain [63652] (1 PDB entry)
  8. 54060Domain d1hzhk2: 1hzh K:114-235 [61442]
    Other proteins in same PDB: d1hzhh1, d1hzhk1, d1hzhl1, d1hzhm1

Details for d1hzhk2

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhk2:

Sequence, based on SEQRES records: (download)

>d1hzhk2 b.1.1.2 (K:114-235) Immunoglobulin (constant domains of L and H chains) {Intact IgG B12 antibody (human), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdk

Sequence, based on observed residues (ATOM records): (download)

>d1hzhk2 b.1.1.2 (K:114-235) Immunoglobulin (constant domains of L and H chains) {Intact IgG B12 antibody (human), kappa L chain}
astkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdk

SCOP Domain Coordinates for d1hzhk2:

Click to download the PDB-style file with coordinates for d1hzhk2.
(The format of our PDB-style files is described here.)

Timeline for d1hzhk2: