SCOP 1.57: Domain d1hzhm2: 1hzh M:108-214

Lineage for d1hzhm2 (1hzh M:108-214)

Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
Species Intact IgG B12 antibody (human), kappa L chain [63652] (1 PDB entry)
Domain d1hzhm2: 1hzh M:108-214 [61448]
Other proteins in same PDB: d1hzhh1, d1hzhk1, d1hzhl1, d1hzhm1

Details for d1hzhm2

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhm2 b.1.1.2 (M:108-214) Immunoglobulin (constant domains of L and H chains) {Intact IgG B12 antibody (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

SCOP Domain Coordinates for d1hzhm2:

Click to download the PDB-style file with coordinates for d1hzhm2.
(The format of our PDB-style files is described here.)

Timeline for d1hzhm2: