SCOP 1.67: Domain d1hxmd1: 1hxm D:1-123

Lineage for d1hxmd1 (1hxm D:1-123)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), delta-chain [TaxId:9606] [48938] (2 PDB entries)
Domain d1hxmd1: 1hxm D:1-123 [61373]
Other proteins in same PDB: d1hxma2, d1hxmb2, d1hxmc2, d1hxmd2, d1hxme2, d1hxmf2, d1hxmg2, d1hxmh2

Details for d1hxmd1

PDB Entry: 1hxm (more details), 3.12 Å

PDB Description: crystal structure of a human vgamma9/vdelta2 t cell receptor

SCOP Domain Sequences for d1hxmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxmd1 b.1.1.1 (D:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain}
aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
itd

SCOP Domain Coordinates for d1hxmd1:

Click to download the PDB-style file with coordinates for d1hxmd1.
(The format of our PDB-style files is described here.)

Timeline for d1hxmd1: