Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.1: Serpins [56573] (1 superfamily) contains a cluster of helices and a beta-sandwich |
Superfamily e.1.1: Serpins [56574] (2 families) |
Family e.1.1.1: Serpins [56575] (17 proteins) |
Protein Antitrypsin, alpha-1 [56582] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56583] (15 PDB entries) |
Domain d1hp7a_: 1hp7 A: [61117] intact chain complexed with bme, zn |
PDB Entry: 1hp7 (more details), 2.1 Å
SCOPe Domain Sequences for d1hp7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hp7a_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} dhptfnkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkgdthdeile glnfnlteipeaqihegfqellhtlnqpdsqlqlttgnglflseglklvdkfledvkkly hseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpf evkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdeg klqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadl sgvteeaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmidqn tksplfmgkvvnptqk
Timeline for d1hp7a_: