SCOP 1.75: Domain d1hp7a_: 1hp7 A:

Lineage for d1hp7a_ (1hp7 A:)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.1: Serpins [56573] (1 superfamily)
   contains a cluster of helices and a beta-sandwich

4. Superfamily e.1.1: Serpins [56574] (1 family)

5. Family e.1.1.1: Serpins [56575] (16 proteins)

6. Protein Antitrypsin, alpha-1 [56582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56583] (15 PDB entries)

8. Domain d1hp7a_: 1hp7 A: [61117]
   intact chain
   complexed with seo, zn; mutant

Details for d1hp7a_

PDB Entry: 1hp7, 2.1 Å

PDB Description: a 2.1 angstrom structure of an uncleaved alpha-1-antitrypsin shows variability of the reactive center and other loops

PDB Compounds: (A:) alpha-1-antitrypsin

SCOP Domain Sequences for d1hp7a_:

Sequence; same for both SEQRES and ATOM records:

>d1hp7a_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
dhptfnkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkgdthdeile
glnfnlteipeaqihegfqellhtlnqpdsqlqlttgnglflseglklvdkfledvkkly
hseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpf
evkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdeg
klqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadl
sgvteeaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmidqn
tksplfmgkvvnptqk

Timeline for d1hp7a_:

• d1hp7a_ first appeared in SCOP 1.57
  
• d1hp7a_ appears in SCOP 1.73
  
• d1hp7a_ appears in SCOPe 2.01
  
• d1hp7a_ appears in the current release, SCOPe 2.08