SCOPe 2.02: Domain d1h8ub_: 1h8u B:

Lineage for d1h8ub_ (1h8u B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Eosinophil major basic protein [64457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64458] (2 PDB entries)

8. Domain d1h8ub_: 1h8u B: [60794]
   complexed with gol, so4

Details for d1h8ub_

PDB Entry: 1h8u, 1.8 Å

PDB Description: crystal structure of the eosinophil major basic protein at 1.8a: an atypical lectin with a paradigm shift in specificity

PDB Compounds: (B:) eosinophil granule major basic protein 1

SCOPe Domain Sequences for d1h8ub_:

Sequence; same for both SEQRES and ATOM records:

>d1h8ub_ d.169.1.1 (B:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]}
cryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritgs
grcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy

Timeline for d1h8ub_:

• d1h8ub_ first appeared in SCOP 1.57
  
• d1h8ub_ appears in SCOPe 2.01
  
• d1h8ub_ appears in SCOPe 2.03
  
• d1h8ub_ appears in the current release, SCOPe 2.08