Lineage for d1h8ub_ (1h8u B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85600Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 85601Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 85602Family d.169.1.1: C-type lectin domain [56437] (15 proteins)
  6. 85615Protein Eosinophil major basic protein [64457] (1 species)
  7. 85616Species Human (Homo sapiens) [TaxId:9606] [64458] (1 PDB entry)
  8. 85618Domain d1h8ub_: 1h8u B: [60794]

Details for d1h8ub_

PDB Entry: 1h8u (more details), 1.8 Å

PDB Description: crystal structure of the eosinophil major basic protein at 1.8a: an atypical lectin with a paradigm shift in specificity

SCOP Domain Sequences for d1h8ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ub_ d.169.1.1 (B:) Eosinophil major basic protein {Human (Homo sapiens)}
cryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritgs
grcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy

SCOP Domain Coordinates for d1h8ub_:

Click to download the PDB-style file with coordinates for d1h8ub_.
(The format of our PDB-style files is described here.)

Timeline for d1h8ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h8ua_