![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Eosinophil major basic protein [64457] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64458] (2 PDB entries) |
![]() | Domain d1h8ua_: 1h8u A: [60793] complexed with gol, so4 |
PDB Entry: 1h8u (more details), 1.8 Å
SCOPe Domain Sequences for d1h8ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ua_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]} ryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritgsg rcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy
Timeline for d1h8ua_: