Class b: All beta proteins [48724] (180 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein Adenovirus fiber protein 'knob' domain [49837] (18 species) |
Species Human adenovirus type 3 [TaxId:45659] [63720] (2 PDB entries) |
Domain d1h7zb_: 1h7z B: [60734] complexed with so4 |
PDB Entry: 1h7z (more details), 1.6 Å
SCOPe Domain Sequences for d1h7zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7zb_ b.21.1.1 (B:) Adenovirus fiber protein 'knob' domain {Human adenovirus type 3 [TaxId: 45659]} knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn vsinvelyfdatghilpdssslktdlelkykqtadfsargfmpsttaypfvlpnagthne nyifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlits pftfsyiredd
Timeline for d1h7zb_: