![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins) |
![]() | Protein Mammalian thioredoxin reductase [64329] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [64330] (1 PDB entry) |
![]() | Domain d1h6ve3: 1h6v E:367-499 [60707] Other proteins in same PDB: d1h6va1, d1h6va2, d1h6vb1, d1h6vb2, d1h6vc1, d1h6vc2, d1h6vd1, d1h6vd2, d1h6ve1, d1h6ve2, d1h6vf1, d1h6vf2 |
PDB Entry: 1h6v (more details), 3 Å
SCOP Domain Sequences for d1h6ve3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6ve3 d.87.1.1 (E:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus)} ydnvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnkcyakvi cnlkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeifttlsvtk rsggdilqsgccg
Timeline for d1h6ve3: