Lineage for d1h6va2 (1h6v A:171-292)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67341Protein Mammalian thioredoxin reductase [63947] (1 species)
  7. 67342Species Rat (Rattus norvegicus) [TaxId:10116] [63948] (1 PDB entry)
  8. 67344Domain d1h6va2: 1h6v A:171-292 [60694]
    Other proteins in same PDB: d1h6va3, d1h6vb3, d1h6vc3, d1h6vd3, d1h6ve3, d1h6vf3

Details for d1h6va2

PDB Entry: 1h6v (more details), 3 Å

PDB Description: mammalian thioredoxin reductase

SCOP Domain Sequences for d1h6va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus)}
pgdkeycissddlfslpycpgktlvvgasyvalecagflagigldvtvmvrsillrgfdq
dmankigehmeehgikfirqfvptkieqieagtpgrlkvtakstnseetiedefntvlla
vg

SCOP Domain Coordinates for d1h6va2:

Click to download the PDB-style file with coordinates for d1h6va2.
(The format of our PDB-style files is described here.)

Timeline for d1h6va2: