Lineage for d1h6kx_ (1h6k X:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862050Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) (S)
  5. 862051Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 862067Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species)
  7. 862068Species Human (Homo sapiens) [TaxId:9606] [64275] (6 PDB entries)
  8. 862070Domain d1h6kx_: 1h6k X: [60684]
    Other proteins in same PDB: d1h6ka1, d1h6ka2, d1h6ka3, d1h6kb1, d1h6kb2, d1h6kb3, d1h6kc1, d1h6kc2, d1h6kc3

Details for d1h6kx_

PDB Entry: 1h6k (more details), 2 Å

PDB Description: nuclear cap binding complex
PDB Compounds: (X:) 20 kda nuclear cap binding protein

SCOP Domain Sequences for d1h6kx_:

Sequence, based on SEQRES records: (download)

>d1h6kx_ d.58.7.1 (X:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
ksctlyvgnlsfytteeqiyelfsksgdikkiimgldkmtacgfcfveyysradaenamr
yingtrlddriirtdwdag

Sequence, based on observed residues (ATOM records): (download)

>d1h6kx_ d.58.7.1 (X:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
ksctlyvgnlsfytteeqiyelfsksgdikkiimgldkmcgfcfveyysradaenamryi
ngtrlddriirtdwdag

SCOP Domain Coordinates for d1h6kx_:

Click to download the PDB-style file with coordinates for d1h6kx_.
(The format of our PDB-style files is described here.)

Timeline for d1h6kx_: