Lineage for d1h6kb1 (1h6k B:26-290)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775465Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 775466Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
    contains three domains of this fold connected with long linkers
  7. 775467Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)
  8. 775474Domain d1h6kb1: 1h6k B:26-290 [60678]
    Other proteins in same PDB: d1h6kx_, d1h6ky_, d1h6kz_

Details for d1h6kb1

PDB Entry: 1h6k (more details), 2 Å

PDB Description: nuclear cap binding complex
PDB Compounds: (B:) cbp80

SCOP Domain Sequences for d1h6kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6kb1 a.118.1.14 (B:26-290) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
etedhleslickvgeksacslesnleglagvleadlpnykskilrllctvarllpeklti
yttlvgllnarnynfggefveamirqlkeslkannyneavylvrflsdlvnchviaapsm
vamfenfvsvtqeedvpqvrrdwyvyaflsslpwvgkelyekkdaemdrifantesylkr
rqkthvpmlqvwtadkphpqeeyldclwaqiqklkkdrwqerhilrpylafdsilcealq
hnlppftppphtedsvypmprvifr

SCOP Domain Coordinates for d1h6kb1:

Click to download the PDB-style file with coordinates for d1h6kb1.
(The format of our PDB-style files is described here.)

Timeline for d1h6kb1: