Class i: Low resolution protein structures [58117] (16 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (2 species) |
Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries) |
Domain d1gixs_: 1gix S: [60542] |
PDB Entry: 1gix (more details), 5.5 Å
SCOP Domain Sequences for d1gixs_:
Sequence, based on SEQRES records: (download)
>d1gixs_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus} mvkirlarfgskhnphyphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverar ywlsvgaqptdtarrllrqagvfrqe
>d1gixs_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d1gixs_: