| Class i: Low resolution protein structures [58117] (16 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (2 species) |
| Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries) |
| Domain d1gixv_: 1gix V: [60545] |
PDB Entry: 1gix (more details), 5.5 Å
SCOP Domain Sequences for d1gixv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gixv_ i.1.1.1 (V:) 70S ribosome functional complex {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr
Timeline for d1gixv_: