Lineage for d1g1uc_ (1g1u C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217440Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 217441Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 217442Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (20 proteins)
  6. 217562Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 217563Species Human (Homo sapiens) [TaxId:9606] [48511] (10 PDB entries)
  8. 217582Domain d1g1uc_: 1g1u C: [60206]

Details for d1g1uc_

PDB Entry: 1g1u (more details), 2.5 Å

PDB Description: the 2.5 angstrom resolution crystal structure of the rxralpha ligand binding domain in tetramer in the absence of ligand

SCOP Domain Sequences for d1g1uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1uc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens)}
pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemle

SCOP Domain Coordinates for d1g1uc_:

Click to download the PDB-style file with coordinates for d1g1uc_.
(The format of our PDB-style files is described here.)

Timeline for d1g1uc_: