PDB entry 1g1u

View 1g1u on RCSB PDB site
Description: the 2.5 angstrom resolution crystal structure of the rxralpha ligand binding domain in tetramer in the absence of ligand
Deposited on 2000-10-13, released 2001-04-25
The last revision prior to the SCOP 1.63 freeze date was dated 2001-04-25, with a file datestamp of 2001-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1g1ua_
  • Chain 'B':
    Domains in SCOP 1.63: d1g1ub_
  • Chain 'C':
    Domains in SCOP 1.63: d1g1uc_
  • Chain 'D':
    Domains in SCOP 1.63: d1g1ud_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1uA (A:)
    pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
    elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
    telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
    qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1uB (B:)
    pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
    elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
    telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
    qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaph
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1uC (C:)
    pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
    elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
    telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
    qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemle
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g1uD (D:)
    pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
    elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
    telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
    qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaph