Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [49242] (11 PDB entries) |
Domain d1ft3b_: 1ft3 B: [60021] mutant |
PDB Entry: 1ft3 (more details), 2.8 Å
SCOPe Domain Sequences for d1ft3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ft3b_ b.1.18.8 (B:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]} mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg mkyiqhtyrkgvkidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd ktdhlswewnltikkdwk
Timeline for d1ft3b_: