Lineage for d1ft3b1 (1ft3 B:67-203)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765599Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2765633Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. 2765638Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)
  8. 2765660Domain d1ft3b1: 1ft3 B:67-203 [60021]
    Other proteins in same PDB: d1ft3a2, d1ft3b2
    mutant

Details for d1ft3b1

PDB Entry: 1ft3 (more details), 2.8 Å

PDB Description: crystal structure of truncated rhogdi k141a mutant
PDB Compounds: (B:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1ft3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft3b1 b.1.18.8 (B:67-203) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
vpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgm
kyiqhtyrkgvkidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddk
tdhlswewnltikkdwk

SCOPe Domain Coordinates for d1ft3b1:

Click to download the PDB-style file with coordinates for d1ft3b1.
(The format of our PDB-style files is described here.)

Timeline for d1ft3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ft3b2