Lineage for d1fnec1 (1fne C:82-182)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760280Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1760386Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 1760390Domain d1fnec1: 1fne C:82-182 [59900]
    Other proteins in same PDB: d1fnea2, d1fneb1, d1fneb2, d1fnec2, d1fned1, d1fned2
    complexed with nag

Details for d1fnec1

PDB Entry: 1fne (more details), 1.9 Å

PDB Description: histocompatibility antigen
PDB Compounds: (C:) protein (MHC class II I-ek, alpha chain)

SCOPe Domain Sequences for d1fnec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnec1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

SCOPe Domain Coordinates for d1fnec1:

Click to download the PDB-style file with coordinates for d1fnec1.
(The format of our PDB-style files is described here.)

Timeline for d1fnec1: