SCOPe 2.05: Domain d1fnea1: 1fne A:82-182

Lineage for d1fnea1 (1fne A:82-182)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d1fnea1: 1fne A:82-182 [59896]
   Other proteins in same PDB: d1fnea2, d1fneb1, d1fneb2, d1fnec2, d1fned1, d1fned2
   complexed with nag

Details for d1fnea1

PDB Entry: 1fne, 1.9 Å

PDB Description: histocompatibility antigen

PDB Compounds: (A:) protein (MHC class II I-ek, alpha chain)

SCOPe Domain Sequences for d1fnea1:

Sequence; same for both SEQRES and ATOM records:

>d1fnea1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

Timeline for d1fnea1:

• d1fnea1 first appeared in SCOP 1.57
  
• d1fnea1 appears in SCOPe 2.04
  
• d1fnea1 appears in SCOPe 2.06
  
• d1fnea1 appears in the current release, SCOPe 2.08