Lineage for d1f9cb1 (1f9c B:131-372)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1148962Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1149027Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)
  6. 1149133Protein Muconate-lactonizing enzyme [51615] (1 species)
  7. 1149134Species Pseudomonas putida [TaxId:303] [51616] (5 PDB entries)
  8. 1149145Domain d1f9cb1: 1f9c B:131-372 [59730]
    Other proteins in same PDB: d1f9ca2, d1f9cb2
    complexed with mn

Details for d1f9cb1

PDB Entry: 1f9c (more details), 2.5 Å

PDB Description: crystal structure of mle d178n variant
PDB Compounds: (B:) protein (muconate cycloisomerase I)

SCOPe Domain Sequences for d1f9cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9cb1 c.1.11.2 (B:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]}
rvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqnlkhvvtikrelg
dsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimade
siesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtl
asahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldearlarf
ar

SCOPe Domain Coordinates for d1f9cb1:

Click to download the PDB-style file with coordinates for d1f9cb1.
(The format of our PDB-style files is described here.)

Timeline for d1f9cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f9cb2