Lineage for d1f9cb1 (1f9c B:131-372)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65496Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 65518Family c.1.11.2: D-glucarate dehydratase-like [51609] (5 proteins)
  6. 65558Protein Muconate-lactonizing enzyme [51615] (1 species)
  7. 65559Species Pseudomonas putida [TaxId:303] [51616] (5 PDB entries)
  8. 65570Domain d1f9cb1: 1f9c B:131-372 [59730]
    Other proteins in same PDB: d1f9ca2, d1f9cb2

Details for d1f9cb1

PDB Entry: 1f9c (more details), 2.5 Å

PDB Description: crystal structure of mle d178n variant

SCOP Domain Sequences for d1f9cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9cb1 c.1.11.2 (B:131-372) Muconate-lactonizing enzyme {Pseudomonas putida}
rvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqnlkhvvtikrelg
dsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimade
siesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtl
asahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldearlarf
ar

SCOP Domain Coordinates for d1f9cb1:

Click to download the PDB-style file with coordinates for d1f9cb1.
(The format of our PDB-style files is described here.)

Timeline for d1f9cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f9cb2