SCOP 1.57: Domain d1f9cb1: 1f9c B:131-372

Lineage for d1f9cb1 (1f9c B:131-372)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (5 proteins)

6. Protein Muconate-lactonizing enzyme [51615] (1 species)

7. Species Pseudomonas putida [TaxId:303] [51616] (5 PDB entries)

8. Domain d1f9cb1: 1f9c B:131-372 [59730]
   Other proteins in same PDB: d1f9ca2, d1f9cb2

Details for d1f9cb1

PDB Entry: 1f9c, 2.5 Å

PDB Description: crystal structure of mle d178n variant

SCOP Domain Sequences for d1f9cb1:

Sequence; same for both SEQRES and ATOM records:

>d1f9cb1 c.1.11.2 (B:131-372) Muconate-lactonizing enzyme {Pseudomonas putida}
rvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqnlkhvvtikrelg
dsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimade
siesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtl
asahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldearlarf
ar

Timeline for d1f9cb1:

• d1f9cb1 is new in SCOP 1.57
  
• d1f9cb1 appears in SCOP 1.59
  
• d1f9cb1 appears in the current release, SCOPe 2.08