SCOP 1.57: Domain d1f4ka_: 1f4k A:

Lineage for d1f4ka_ (1f4k A:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families)

5. Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)

6. Protein Replication terminator protein (RTP) [46808] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [46809] (2 PDB entries)

8. Domain d1f4ka_: 1f4k A: [59646]

Details for d1f4ka_

PDB Entry: 1f4k, 2.5 Å

PDB Description: crystal structure of the replication terminator protein/b-site dna complex

SCOP Domain Sequences for d1f4ka_:

Sequence; same for both SEQRES and ATOM records:

>d1f4ka_ a.4.5.7 (A:) Replication terminator protein (RTP) {Bacillus subtilis}
stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf

Timeline for d1f4ka_:

• d1f4ka_ is new in SCOP 1.57
  
• d1f4ka_ appears in SCOP 1.59
  
• d1f4ka_ appears in the current release, SCOPe 2.08