Lineage for d1f4kb_ (1f4k B:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) 
Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein) Protein Replication terminator protein (RTP) [46808] (1 species) Species Bacillus subtilis [TaxId:1423] [46809] (2 PDB entries) 
Domain d1f4kb_: 1f4k B: [59647]
Details for d1f4kb_
PDB Entry: 1f4k (more details), 2.5 Å
PDB Description: crystal structure of the replication terminator protein/b-site dna complex
SCOP Domain Sequences for d1f4kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4kb_ a.4.5.7 (B:) Replication terminator protein (RTP) {Bacillus subtilis}
stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf
SCOP Domain Coordinates for d1f4kb_:
Click to download the PDB-style file with coordinates for d1f4kb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f4kb_:
- d1f4kb_ is new in SCOP 1.57
- d1f4kb_ appears in SCOP 1.59
- d1f4kb_ appears in the current release, SCOPe 2.08
View in 3D
