PDB entry 1f4k

View 1f4k on RCSB PDB site
Description: crystal structure of the replication terminator protein/b-site dna complex
Deposited on 2000-06-08, released 2001-06-08
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-08, with a file datestamp of 2001-06-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1f4ka_
  • Chain 'B':
    Domains in SCOP 1.57: d1f4kb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4kA (A:)
    stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
    gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4kB (B:)
    stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
    gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf