SCOPe 2.02: Domain d1ecsa_: 1ecs A:

Lineage for d1ecsa_ (1ecs A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Bleomycin resistance protein, BRP [54599] (3 species)
   Active as dimer

7. Species Klebsiella pneumoniae [TaxId:573] [64256] (4 PDB entries)
   the transposon tn5-encoding bleomycin-binding protein, BlmT

8. Domain d1ecsa_: 1ecs A: [59407]
   complexed with ca, pg4

Details for d1ecsa_

PDB Entry: 1ecs, 1.7 Å

PDB Description: the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5

PDB Compounds: (A:) bleomycin resistance protein

SCOPe Domain Sequences for d1ecsa_:

Sequence; same for both SEQRES and ATOM records:

>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqgwggtmaalvdpdgtllrliqnel

Timeline for d1ecsa_:

• d1ecsa_ first appeared in SCOP 1.57
  
• d1ecsa_ appears in SCOPe 2.01
  
• d1ecsa_ appears in SCOPe 2.03
  
• d1ecsa_ appears in the current release, SCOPe 2.08