Lineage for d1ecsa_ (1ecs A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) 
Family d.32.1.2: Bleomycin resistance protein, BRP [54598] (1 protein) Protein Bleomycin resistance protein, BRP [54599] (3 species) 
Species Klebsiella pneumoniae [TaxId:573] [64256] (2 PDB entries) 
Domain d1ecsa_: 1ecs A: [59407]
Details for d1ecsa_
PDB Entry: 1ecs (more details), 1.7 Å
PDB Description: the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5
SCOP Domain Sequences for d1ecsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqgwggtmaalvdpdgtllrliqnel
SCOP Domain Coordinates for d1ecsa_:
Click to download the PDB-style file with coordinates for d1ecsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ecsa_:
- d1ecsa_ is new in SCOP 1.57
- d1ecsa_ appears in SCOP 1.59
- d1ecsa_ appears in the current release, SCOPe 2.08
View in 3D
