![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (4 proteins) |
![]() | Protein Chitinase B [54560] (1 species) |
![]() | Species Serratia marcescens [TaxId:615] [54561] (5 PDB entries) |
![]() | Domain d1e6pa3: 1e6p A:292-379 [59316] Other proteins in same PDB: d1e6pa1, d1e6pa2, d1e6pb1, d1e6pb2 |
PDB Entry: 1e6p (more details), 1.7 Å
SCOP Domain Sequences for d1e6pa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6pa3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens} ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg nygyqrlwndktktpylyhaqnglfvty
Timeline for d1e6pa3: