SCOP 1.57: Domain d1e6pb1: 1e6p B:447-499

Lineage for d1e6pb1 (1e6p B:447-499)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.72: WW domain-like [51044] (2 superfamilies)

4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family)

5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)

6. Protein Chitinase B, C-terminal domain [51061] (1 species)

7. Species Serratia marcescens [TaxId:615] [51062] (5 PDB entries)

8. Domain d1e6pb1: 1e6p B:447-499 [59317]
   Other proteins in same PDB: d1e6pa2, d1e6pa3, d1e6pb2, d1e6pb3

Details for d1e6pb1

PDB Entry: 1e6p, 1.7 Å

PDB Description: chitinase b from serratia marcescens inactive mutant e144q

SCOP Domain Sequences for d1e6pb1:

Sequence; same for both SEQRES and ATOM records:

>d1e6pb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

Timeline for d1e6pb1:

• d1e6pb1 is new in SCOP 1.57
  
• d1e6pb1 appears in SCOP 1.59
  
• d1e6pb1 appears in the current release, SCOPe 2.08