SCOPe 2.05: Domain d1e5wa3: 1e5w A:1-87

Lineage for d1e5wa3 (1e5w A:1-87)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.4: First domain of FERM [54256] (7 proteins)

6. Protein Moesin [54257] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54258] (3 PDB entries)
   Uniprot P26038 4-297

8. Domain d1e5wa3: 1e5w A:1-87 [59282]
   Other proteins in same PDB: d1e5wa1, d1e5wa2

Details for d1e5wa3

PDB Entry: 1e5w, 2.7 Å

PDB Description: Structure of isolated FERM domain and first long helix of moesin

PDB Compounds: (A:) moesin

SCOPe Domain Sequences for d1e5wa3:

Sequence; same for both SEQRES and ATOM records:

>d1e5wa3 d.15.1.4 (A:1-87) Moesin {Human (Homo sapiens) [TaxId: 9606]}
mpktisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlk
lnkkvtaqdvrkespllfkfrakfype

Timeline for d1e5wa3:

• d1e5wa3 first appeared in SCOP 1.57
  
• d1e5wa3 appears in SCOPe 2.04
  
• d1e5wa3 appears in SCOPe 2.06
  
• d1e5wa3 appears in the current release, SCOPe 2.08