Class a: All alpha proteins [46456] (286 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) automatically mapped to Pfam PF00373 |
Family a.11.2.1: Second domain of FERM [47032] (9 proteins) |
Protein Moesin [47033] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47034] (3 PDB entries) Uniprot P26038 4-297 |
Domain d1e5wa1: 1e5w A:88-198 [59280] Other proteins in same PDB: d1e5wa2, d1e5wa3 |
PDB Entry: 1e5w (more details), 2.7 Å
SCOPe Domain Sequences for d1e5wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5wa1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} dvseeliqditqrlfflqvkegilnddiycppetavllasyavqskygdfnkevhksgyl agdkllpqrvleqhklnkdqweeriqvwheehrgmlredavleylkiaqdl
Timeline for d1e5wa1: