![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 2 [63409] (4 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [56001] (3 PDB entries) |
![]() | Domain d3bccb2: 3bcc B:236-439 [59059] Other proteins in same PDB: d3bcca1, d3bcca2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_ complexed with amy, fes, hem, sig |
PDB Entry: 3bcc (more details), 3.7 Å
SCOPe Domain Sequences for d3bccb2:
Sequence, based on SEQRES records: (download)
>d3bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]} kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrglnatssl yqavakgvhqpfdvsafnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsne nvqaaknklkakylmsvessegfleevgsqalaagsynppstvlqqidavadadvikaak kfvsrqksmaasgnlghtpfvdel
>d3bccb2 d.185.1.1 (B:236-439) Cytochrome bc1 core subunit 2 {Chicken (Gallus gallus) [TaxId: 9031]} kakyrggeireqngdslvhaaivaesaaiggaeanafsvlqhvlganphvkrgnpfdvsa fnasysdsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylms vessegfleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlg htpfvdel
Timeline for d3bccb2: