![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries) |
![]() | Domain d3bcca1: 3bcc A:4-232 [59056] Other proteins in same PDB: d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_ complexed with amy, fes, hem, sig |
PDB Entry: 3bcc (more details), 3.7 Å
SCOPe Domain Sequences for d3bcca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bcca1 d.185.1.1 (A:4-232) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus) [TaxId: 9031]} yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptls
Timeline for d3bcca1: