| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
| Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein) |
| Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (4 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [81492] (3 PDB entries) |
| Domain d3bccd3: 3bcc D:196-241 [43712] Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_ complexed with amy, fes, hem, sig |
PDB Entry: 3bcc (more details), 3.7 Å
SCOPe Domain Sequences for d3bccd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bccd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Chicken (Gallus gallus) [TaxId: 9031]}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk
Timeline for d3bccd3: