Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) |
Family d.185.1.1: MPP-like [63412] (4 proteins) |
Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries) |
Domain d3bcca1: 3bcc A:4-232 [59056] Other proteins in same PDB: d3bccb1, d3bccb2, d3bccc1, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf1, d3bccg1, d3bcch1, d3bccj1 |
PDB Entry: 3bcc (more details), 3.7 Å
SCOP Domain Sequences for d3bcca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bcca1 d.185.1.1 (A:4-232) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus)} yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptls
Timeline for d3bcca1: