SCOP 1.57: Domain d3bcca1: 3bcc A:4-232

Lineage for d3bcca1 (3bcc A:4-232)

Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
Family d.185.1.1: MPP-like [63412] (4 proteins)
Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries)
Domain d3bcca1: 3bcc A:4-232 [59056]
Other proteins in same PDB: d3bccb1, d3bccb2, d3bccc1, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf1, d3bccg1, d3bcch1, d3bccj1

Details for d3bcca1

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bcca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bcca1 d.185.1.1 (A:4-232) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus)}
yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla
fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle
dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt
eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptls

SCOP Domain Coordinates for d3bcca1:

Click to download the PDB-style file with coordinates for d3bcca1.
(The format of our PDB-style files is described here.)

Timeline for d3bcca1: