SCOP 1.57: Domain d3bcch1: 3bcc H:

Lineage for d3bcch1 (3bcc H:)

1. Root: SCOP 1.57

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)

6. Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56909] (3 PDB entries)

8. Domain d3bcch1: 3bcc H: [43716]
   Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccd2, d3bcce1

Details for d3bcch1

PDB Entry: 3bcc, 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bcch1:

Sequence; same for both SEQRES and ATOM records:

>d3bcch1 f.2.1.8 (H:) Cytochrome bc1 transmembrane subunits {Chicken (Gallus gallus)}
lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfdflhardhcvahk
lfnslk

Timeline for d3bcch1:

• d3bcch1 first appeared (with stable ids) in SCOP 1.55
  
• d3bcch1 appears in SCOP 1.59
  
• d3bcch1 appears in the current release, SCOPe 2.08, called d3bcch_