Lineage for d1hyoa2 (1hyo A:119-416)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561549Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 2561550Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 2561551Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 2561581Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species)
  7. 2561582Species Mouse (Mus musculus) [TaxId:10090] [56532] (5 PDB entries)
  8. 2561583Domain d1hyoa2: 1hyo A:119-416 [59002]
    Other proteins in same PDB: d1hyoa1, d1hyob1, d1hyob3
    complexed with act, ca, hbu, mg, ni

Details for d1hyoa2

PDB Entry: 1hyo (more details), 1.3 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase complexed with 4-(hydroxymethylphosphinoyl)-3-oxo-butanoic acid
PDB Compounds: (A:) fumarylacetoacetate hydrolase

SCOPe Domain Sequences for d1hyoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyoa2 d.177.1.1 (A:119-416) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpal

SCOPe Domain Coordinates for d1hyoa2:

Click to download the PDB-style file with coordinates for d1hyoa2.
(The format of our PDB-style files is described here.)

Timeline for d1hyoa2: