Lineage for d1hyoa1 (1hyo A:1-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784487Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families) (S)
    automatically mapped to Pfam PF09298
  5. 2784488Family b.34.8.1: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63434] (1 protein)
    contains 5 short helices in the loop between the third and fourth strands
  6. 2784489Protein Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63435] (1 species)
  7. 2784490Species Mouse (Mus musculus) [TaxId:10090] [63436] (5 PDB entries)
  8. 2784491Domain d1hyoa1: 1hyo A:1-118 [59001]
    Other proteins in same PDB: d1hyoa2, d1hyob2, d1hyob3
    complexed with act, ca, hbu, mg, ni

Details for d1hyoa1

PDB Entry: 1hyo (more details), 1.3 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase complexed with 4-(hydroxymethylphosphinoyl)-3-oxo-butanoic acid
PDB Compounds: (A:) fumarylacetoacetate hydrolase

SCOPe Domain Sequences for d1hyoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyoa1 b.34.8.1 (A:1-118) Fumarylacetoacetate hydrolase, FAH, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp

SCOPe Domain Coordinates for d1hyoa1:

Click to download the PDB-style file with coordinates for d1hyoa1.
(The format of our PDB-style files is described here.)

Timeline for d1hyoa1: